KIAA1191 Antikörper (Middle Region)

Produktnummer ABIN633021

Produktdetails anti-KIAA1191 Antikörper

Target: KIAA1191

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIAA1191 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIAA1191 antibody was raised against the middle region of KIAA1191

Aufreinigung: Affinity purified

Immunogen: KIAA1191 antibody was raised using the middle region of KIAA1191 corresponding to a region with amino acids TKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA1191 Blocking Peptide, catalog no. 33R-9155, is also available for use as a blocking control in assays to test for specificity of this KIAA1191 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1191 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIAA1191

Target: KIAA1191

Andere Bezeichnung: KIAA1191 (KIAA1191 Produkte)

Synonyme: p60MONOX antikoerper, 4930558H15Rik antikoerper, C81457 antikoerper, Kiaa1191 antikoerper, P33monox antikoerper, P33MONOX antikoerper, p33monox antikoerper, DKFZp469A246 antikoerper, KIAA1191 antikoerper, RIKEN cDNA 4833439L19 gene antikoerper, KIAA1191 L homeolog antikoerper, KIAA1191 ortholog antikoerper, KIAA1191 antikoerper, 4833439L19Rik antikoerper, kiaa1191.L antikoerper, kiaa1191 antikoerper, Kiaa1191 antikoerper

Hintergrund: The function of KIAA1191 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 33 kDa (MW of target protein)