ERMN Antikörper (Middle Region)

Produktnummer ABIN633019

Produktdetails anti-ERMN Antikörper

Target: ERMN (Ermin, ERM-Like Protein (ERMN))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERMN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIAA1189 antibody was raised against the middle region of Kiaa1189

Aufreinigung: Affinity purified

Immunogen: KIAA1189 antibody was raised using the middle region of Kiaa1189 corresponding to a region with amino acids RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA1189 Blocking Peptide, catalog no. 33R-8249, is also available for use as a blocking control in assays to test for specificity of this KIAA1189 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1189 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERMN

Target: ERMN (Ermin, ERM-Like Protein (ERMN))

Andere Bezeichnung: KIAA1189 (ERMN Produkte)

Synonyme: JN antikoerper, KIAA1189 antikoerper, ermin antikoerper, A330104H05Rik antikoerper, AI854460 antikoerper, mKIAA1189 antikoerper, RGD1308367 antikoerper, juxtanodin antikoerper, ermin antikoerper, ermin, ERM-like protein antikoerper, ERMN antikoerper, Ermn antikoerper

Hintergrund: The function of KIAA1189 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 34 kDa (MW of target protein)