CCT6B Antikörper

Produktnummer ABIN633005

Produktdetails anti-CCT6B Antikörper

Target: CCT6B (T-Complex Protein 1 Subunit zeta-2-Like (CCT6B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCT6B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CCT6 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCT6B Blocking Peptide, catalog no. 33R-9436, is also available for use as a blocking control in assays to test for specificity of this CCT6B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCT6B

Target: CCT6B (T-Complex Protein 1 Subunit zeta-2-Like (CCT6B))

Andere Bezeichnung: CCT6B (CCT6B Produkte)

Synonyme: CCT-zeta-2 antikoerper, CCTZ-2 antikoerper, Cctz2 antikoerper, TCP-1-zeta-2 antikoerper, TSA303 antikoerper, CCTzeta-2 antikoerper, Cctz-2 antikoerper, chaperonin containing TCP1 subunit 6B antikoerper, T-complex protein 1 subunit zeta-2-like antikoerper, t-complex protein 1 subunit zeta-2-like antikoerper, chaperonin containing Tcp1, subunit 6b (zeta) antikoerper, CCT6B antikoerper, Cct6b antikoerper, LOC100445522 antikoerper, LOC100616822 antikoerper

Hintergrund: CCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.

Molekulargewicht: 58 kDa (MW of target protein)