Ribose 5-Phosphate Isomerase A (RPIA) Antikörper

Produktnummer ABIN632996

Produktdetails

Target: Ribose 5-Phosphate Isomerase A (RPIA)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPIA Blocking Peptide, catalog no. 33R-6341, is also available for use as a blocking control in assays to test for specificity of this RPIA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPIA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Ribose 5-Phosphate Isomerase A (RPIA)

Andere Bezeichnung: RPIA (RPIA Produkte)

Synonyme: MGC83218 antikoerper, RPI antikoerper, zgc:103524 antikoerper, ribose 5-phosphate isomerase A L homeolog antikoerper, ribose-5-phosphate isomerase antikoerper, ribose 5-phosphate isomerase A antikoerper, ribose 5-phosphate isomerase A (ribose 5-phosphate epimerase) antikoerper, rpia.L antikoerper, LOC475755 antikoerper, RPIA antikoerper, MSP_RS04925 antikoerper, EAMY_RS20365 antikoerper, Rpia antikoerper, rpia antikoerper

Hintergrund: Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Ribonucleoside Biosynthetic Process