TTC35 Antikörper (Middle Region)

Produktnummer ABIN632993

Produktdetails anti-TTC35 Antikörper

Target: TTC35 (Tetratricopeptide Repeat Domain 35 (TTC35))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TTC35 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TTC35 antibody was raised against the middle region of TTC35

Aufreinigung: Affinity purified

Immunogen: TTC35 antibody was raised using the middle region of TTC35 corresponding to a region with amino acids IQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TTC35 Blocking Peptide, catalog no. 33R-4119, is also available for use as a blocking control in assays to test for specificity of this TTC35 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC35 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TTC35

Target: TTC35 (Tetratricopeptide Repeat Domain 35 (TTC35))

Andere Bezeichnung: TTC35 (TTC35 Produkte)

Synonyme: TTC35 antikoerper, KIAA0103 antikoerper, kiaa0103 antikoerper, ttc35 antikoerper, 4921531G14Rik antikoerper, AV060620 antikoerper, AW209495 antikoerper, Ttc35 antikoerper, RGD1310430 antikoerper, emc2-b antikoerper, ttc35-b antikoerper, zgc:73154 antikoerper, zgc:86891 antikoerper, ER membrane protein complex subunit 2 antikoerper, tetratricopeptide repeat domain 35 antikoerper, ER membrane protein complex subunit 2 S homeolog antikoerper, EMC2 antikoerper, emc2 antikoerper, CC1G_12481 antikoerper, Ttc35 antikoerper, Emc2 antikoerper, emc2.S antikoerper

Hintergrund: The function of TTC35 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 35 kDa (MW of target protein)