NT5C1B Antikörper (N-Term)

Produktnummer ABIN632978

Produktdetails anti-NT5C1B Antikörper

Target: NT5C1B (5'-Nucleotidase, Cytosolic IB (NT5C1B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NT5C1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NT5 C5 antibody was raised against the N terminal of NT5 5

Aufreinigung: Affinity purified

Immunogen: NT5 C5 antibody was raised using the N terminal of NT5 5 corresponding to a region with amino acids MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NT5C1B Blocking Peptide, catalog no. 33R-6484, is also available for use as a blocking control in assays to test for specificity of this NT5C1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NT5C1B

Target: NT5C1B (5'-Nucleotidase, Cytosolic IB (NT5C1B))

Andere Bezeichnung: NT5C1B (NT5C1B Produkte)

Synonyme: 4921514H13Rik antikoerper, AIRP antikoerper, CN-IB antikoerper, Rdh14 antikoerper, CN1B antikoerper, zgc:163054 antikoerper, 5'-nucleotidase, cytosolic IB antikoerper, 5'-nucleotidase, cytosolic IB a antikoerper, Nt5c1b antikoerper, NT5C1B antikoerper, nt5c1ba antikoerper

Hintergrund: Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.

Molekulargewicht: 61 kDa (MW of target protein)