NT5C1B Antikörper (N-Term)

Produktnummer ABIN632978

Der Kaninchen Polyklonal anti-NT5C1B Antikörper wird verwendet zum Nachweis von NT5C1B in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für NT5C1B Antikörper (N-Term) (ABIN632978)

Target: NT5C1B (5'-Nucleotidase, Cytosolic IB (NT5C1B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NT5C1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NT5C1B Antikörper

Bindungsspezifität: N-Term

Spezifität: NT5 C5 antibody was raised against the N terminal of NT5 5

Aufreinigung: Affinity purified

Immunogen: NT5 C5 antibody was raised using the N terminal of NT5 5 corresponding to a region with amino acids MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NT5C1B Blocking Peptide, (ABIN5615073), is also available for use as a blocking control in assays to test for specificity of this NT5C1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NT5C1B

Target: NT5C1B (5'-Nucleotidase, Cytosolic IB (NT5C1B))

Andere Bezeichnung: NT5C1B

Hintergrund: Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.

Molekulargewicht: 61 kDa (MW of target protein)