FAM36A Antikörper (Middle Region)
-
- Target Alle FAM36A Produkte
- FAM36A (Family with Sequence Similarity 36, Member A (FAM36A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM36A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM36 A antibody was raised against the middle region of FAM36
- Aufreinigung
- Affinity purified
- Immunogen
- FAM36 A antibody was raised using the middle region of FAM36 corresponding to a region with amino acids LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM36A Blocking Peptide, catalog no. 33R-4967, is also available for use as a blocking control in assays to test for specificity of this FAM36A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM36A (Family with Sequence Similarity 36, Member A (FAM36A))
- Andere Bezeichnung
- FAM36A (FAM36A Produkte)
- Synonyme
- FAM36A antikoerper, 2310005N03Rik antikoerper, Fam36a antikoerper, RGD1309105 antikoerper, cox20 antikoerper, fam36a antikoerper, COX20, cytochrome c oxidase assembly factor antikoerper, COX20 Cox2 chaperone antikoerper, COX20 cytochrome C oxidase assembly factor antikoerper, COX20 cytochrome c oxidase assembly factor L homeolog antikoerper, COX20 antikoerper, Cox20 antikoerper, cox20.L antikoerper
- Hintergrund
- FAM36A is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of FAM36A remains unknown.
- Molekulargewicht
- 13 kDa (MW of target protein)
-