TBC1D13 Antikörper (Middle Region)

Produktnummer ABIN632962

Produktdetails anti-TBC1D13 Antikörper

Target: TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBC1D13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TBC1 D13 antibody was raised against the middle region of TBC1 13

Aufreinigung: Affinity purified

Immunogen: TBC1 D13 antibody was raised using the middle region of TBC1 13 corresponding to a region with amino acids FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBC1D13 Blocking Peptide, catalog no. 33R-2969, is also available for use as a blocking control in assays to test for specificity of this TBC1D13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBC1D13

Target: TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))

Andere Bezeichnung: TBC1D13 (TBC1D13 Produkte)

Synonyme: 2600014A06Rik antikoerper, BC025586 antikoerper, TBC1 domain family member 13 antikoerper, TBC1 domain family, member 13 antikoerper, TBC1D13 antikoerper, Tbc1d13 antikoerper

Hintergrund: TBC1D13 may act as a GTPase-activating protein for Rab family proteins.

Molekulargewicht: 44 kDa (MW of target protein)