TBC1D13 Antikörper (Middle Region)

Produktnummer ABIN632962

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch TBC1D13 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für TBC1D13 Antikörper (Middle Region) (ABIN632962)

Target: TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBC1D13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TBC1D13 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TBC1 D13 antibody was raised against the middle region of TBC1 13

Aufreinigung: Affinity purified

Immunogen: TBC1 D13 antibody was raised using the middle region of TBC1 13 corresponding to a region with amino acids FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBC1D13 Blocking Peptide, (ABIN938355), is also available for use as a blocking control in assays to test for specificity of this TBC1D13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBC1D13

Target: TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))

Andere Bezeichnung: TBC1D13

Hintergrund: TBC1D13 may act as a GTPase-activating protein for Rab family proteins.

Molekulargewicht: 44 kDa (MW of target protein)