TBC1D13 Antikörper (Middle Region)
-
- Target Alle TBC1D13 Antikörper anzeigen
- TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TBC1D13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TBC1 D13 antibody was raised against the middle region of TBC1 13
- Aufreinigung
- Affinity purified
- Immunogen
- TBC1 D13 antibody was raised using the middle region of TBC1 13 corresponding to a region with amino acids FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS
- Top Product
- Discover our top product TBC1D13 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TBC1D13 Blocking Peptide, catalog no. 33R-2969, is also available for use as a blocking control in assays to test for specificity of this TBC1D13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))
- Andere Bezeichnung
- TBC1D13 (TBC1D13 Produkte)
- Synonyme
- 2600014A06Rik antikoerper, BC025586 antikoerper, TBC1 domain family member 13 antikoerper, TBC1 domain family, member 13 antikoerper, TBC1D13 antikoerper, Tbc1d13 antikoerper
- Hintergrund
- TBC1D13 may act as a GTPase-activating protein for Rab family proteins.
- Molekulargewicht
- 44 kDa (MW of target protein)
-