PDXP Antikörper
-
- Target Alle PDXP Antikörper anzeigen
- PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))
-
Reaktivität
- Maus, Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDXP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PDXP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI
- Top Product
- Discover our top product PDXP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PDXP Blocking Peptide, catalog no. 33R-2122, is also available for use as a blocking control in assays to test for specificity of this PDXP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))
- Andere Bezeichnung
- PDXP (PDXP Produkte)
- Synonyme
- CIN antikoerper, PLP antikoerper, dJ37E16.5 antikoerper, 1600027H05Rik antikoerper, AB041662 antikoerper, PLPP antikoerper, Rbp1 antikoerper, pyridoxal phosphatase antikoerper, pyridoxal (pyridoxine, vitamin B6) phosphatase antikoerper, PDXP antikoerper, Pdxp antikoerper
- Hintergrund
- Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.
- Molekulargewicht
- 32 kDa (MW of target protein)
-