PDXP Antikörper

Produktnummer ABIN632951

Produktdetails anti-PDXP Antikörper

Target: PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))

Reaktivität: Maus, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDXP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PDXP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDXP Blocking Peptide, catalog no. 33R-2122, is also available for use as a blocking control in assays to test for specificity of this PDXP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDXP

Target: PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))

Andere Bezeichnung: PDXP (PDXP Produkte)

Synonyme: CIN antikoerper, PLP antikoerper, dJ37E16.5 antikoerper, 1600027H05Rik antikoerper, AB041662 antikoerper, PLPP antikoerper, Rbp1 antikoerper, pyridoxal phosphatase antikoerper, pyridoxal (pyridoxine, vitamin B6) phosphatase antikoerper, PDXP antikoerper, Pdxp antikoerper

Hintergrund: Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.

Molekulargewicht: 32 kDa (MW of target protein)