ACTR10 Antikörper

Produktnummer ABIN632949

Produktdetails anti-ACTR10 Antikörper

Target: ACTR10 (Actin-Related Protein 10 Homolog (ACTR10))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTR10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ACTR10 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACTR10 Blocking Peptide, catalog no. 33R-8598, is also available for use as a blocking control in assays to test for specificity of this ACTR10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACTR10

Target: ACTR10 (Actin-Related Protein 10 Homolog (ACTR10))

Andere Bezeichnung: ACTR10 (ACTR10 Produkte)

Synonyme: ACTR11 antikoerper, Arp11 antikoerper, HARP11 antikoerper, Actr11 antikoerper, actin related protein 10 homolog antikoerper, actin-related protein 10 homolog antikoerper, ARP10 actin-related protein 10 antikoerper, ACTR10 antikoerper, Actr10 antikoerper

Hintergrund: ACTR10 may be involved in protein binding.

Molekulargewicht: 46 kDa (MW of target protein)