SMU1 Antikörper

Produktnummer ABIN632943

Produktdetails anti-SMU1 Antikörper

Target: SMU1 (Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMU1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SMU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMU1 Blocking Peptide, catalog no. 33R-4615, is also available for use as a blocking control in assays to test for specificity of this SMU1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMU1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMU1

Target: SMU1 (Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1))

Andere Bezeichnung: SMU1 (SMU1 Produkte)

Synonyme: SMU1 antikoerper, BWD antikoerper, RP11-54K16.3 antikoerper, SMU-1 antikoerper, fSAP57 antikoerper, 2600001O03Rik antikoerper, 2610203K23Rik antikoerper, AB044414 antikoerper, AI845086 antikoerper, AW556129 antikoerper, Bwd antikoerper, Smu-1 antikoerper, zgc:56147 antikoerper, SMU1, DNA replication regulator and spliceosomal factor antikoerper, WD40 repeat-containing protein SMU1 antikoerper, smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans) antikoerper, DNA replication regulator and spliceosomal factor antikoerper, SMU1, DNA replication regulator and spliceosomal factor a antikoerper, SMU1 antikoerper, LOC100180093 antikoerper, Smu1 antikoerper, smu1a antikoerper

Hintergrund: SMU1 acts a s a suppressor of mec-8 and unc-52 homolog.

Molekulargewicht: 57 kDa (MW of target protein)