TASP1 Antikörper (Middle Region)

Produktnummer ABIN632927

Der Kaninchen Polyklonal anti-TASP1 Antikörper wird verwendet zum Nachweis von TASP1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für TASP1 Antikörper (Middle Region) (ABIN632927)

Target: TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TASP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TASP1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TASP1 antibody was raised against the middle region of TASP1

Aufreinigung: Affinity purified

Immunogen: TASP1 antibody was raised using the middle region of TASP1 corresponding to a region with amino acids QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TASP1 Blocking Peptide, (ABIN5616507), is also available for use as a blocking control in assays to test for specificity of this TASP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TASP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TASP1

Target: TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))

Andere Bezeichnung: TASP1

Hintergrund: This gene encodes an endopeptidase that cleaves specific substrates following aspartate residues. The encoded protein undergoes posttranslational autoproteolytic processing to generate alpha and beta subunits.

Molekulargewicht: 19 kDa (MW of target protein)