TASP1 Antikörper (Middle Region)
-
- Target Alle TASP1 Antikörper anzeigen
- TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TASP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TASP1 antibody was raised against the middle region of TASP1
- Aufreinigung
- Affinity purified
- Immunogen
- TASP1 antibody was raised using the middle region of TASP1 corresponding to a region with amino acids QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI
- Top Product
- Discover our top product TASP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TASP1 Blocking Peptide, catalog no. 33R-7663, is also available for use as a blocking control in assays to test for specificity of this TASP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TASP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))
- Andere Bezeichnung
- TASP1 (TASP1 Produkte)
- Synonyme
- 4930485D02Rik antikoerper, AW986064 antikoerper, RGD1308591 antikoerper, C20orf13 antikoerper, dJ585I14.2 antikoerper, taspase, threonine aspartase 1 antikoerper, taspase 1 antikoerper, Tasp1 antikoerper, TASP1 antikoerper
- Hintergrund
- This gene encodes an endopeptidase that cleaves specific substrates following aspartate residues. The encoded protein undergoes posttranslational autoproteolytic processing to generate alpha and beta subunits.
- Molekulargewicht
- 19 kDa (MW of target protein)
-