MIER2 Antikörper (Middle Region)
-
- Target Alle MIER2 Antikörper anzeigen
- MIER2 (Mesoderm Induction Early Response 1, Family Member 2 (MIER2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MIER2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MIER2 antibody was raised against the middle region of MIER2
- Aufreinigung
- Affinity purified
- Immunogen
- MIER2 antibody was raised using the middle region of MIER2 corresponding to a region with amino acids RLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGE
- Top Product
- Discover our top product MIER2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MIER2 Blocking Peptide, catalog no. 33R-8048, is also available for use as a blocking control in assays to test for specificity of this MIER2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MIER2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MIER2 (Mesoderm Induction Early Response 1, Family Member 2 (MIER2))
- Andere Bezeichnung
- MIER2 (MIER2 Produkte)
- Synonyme
- KIAA1193 antikoerper, Mi-er2 antikoerper, 2700087H15Rik antikoerper, mKIAA1193 antikoerper, RGD1307278 antikoerper, mesoderm induction early response 1, family member 2 S homeolog antikoerper, mesoderm induction early response 1, family member 2 antikoerper, MIER family member 2 antikoerper, mier2.S antikoerper, mier2 antikoerper, MIER2 antikoerper, Mier2 antikoerper
- Hintergrund
- MIER2 is a transcriptional repressor.
- Molekulargewicht
- 60 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-