CUTC Antikörper

Produktnummer ABIN632915

Produktdetails anti-CUTC Antikörper

Target: CUTC (CutC Copper Transporter Homolog (CUTC))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CUTC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CUTC antibody was raised using a synthetic peptide corresponding to a region with amino acids LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CUTC Blocking Peptide, catalog no. 33R-4899, is also available for use as a blocking control in assays to test for specificity of this CUTC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUTC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CUTC

Target: CUTC (CutC Copper Transporter Homolog (CUTC))

Andere Bezeichnung: CUTC (CUTC Produkte)

Synonyme: zgc:103406 antikoerper, RP11-483F11.3 antikoerper, 2310039I18Rik antikoerper, AI326282 antikoerper, CGI-32 antikoerper, cutC copper transporter antikoerper, cutC copper transporter homolog (E. coli) antikoerper, CUTC antikoerper, cutc antikoerper, Cutc antikoerper

Hintergrund: Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis