CUTC Antikörper
-
- Target Alle CUTC Antikörper anzeigen
- CUTC (CutC Copper Transporter Homolog (CUTC))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CUTC Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CUTC antibody was raised using a synthetic peptide corresponding to a region with amino acids LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST
- Top Product
- Discover our top product CUTC Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CUTC Blocking Peptide, catalog no. 33R-4899, is also available for use as a blocking control in assays to test for specificity of this CUTC antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUTC antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CUTC (CutC Copper Transporter Homolog (CUTC))
- Andere Bezeichnung
- CUTC (CUTC Produkte)
- Synonyme
- zgc:103406 antikoerper, RP11-483F11.3 antikoerper, 2310039I18Rik antikoerper, AI326282 antikoerper, CGI-32 antikoerper, cutC copper transporter antikoerper, cutC copper transporter homolog (E. coli) antikoerper, CUTC antikoerper, cutc antikoerper, Cutc antikoerper
- Hintergrund
- Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper.
- Molekulargewicht
- 29 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-