PPID Antikörper
-
- Target Alle PPID Antikörper anzeigen
- PPID (Peptidylprolyl Isomerase D (PPID))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPID Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PPID antibody was raised using a synthetic peptide corresponding to a region with amino acids CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
- Top Product
- Discover our top product PPID Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPID Blocking Peptide, catalog no. 33R-1762, is also available for use as a blocking control in assays to test for specificity of this PPID antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPID antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPID (Peptidylprolyl Isomerase D (PPID))
- Andere Bezeichnung
- PPID (PPID Produkte)
- Synonyme
- PPID antikoerper, CYP-40 antikoerper, CYPD antikoerper, Cyp-40 antikoerper, CypD antikoerper, wu:fb18b07 antikoerper, zgc:86711 antikoerper, 4930564J03Rik antikoerper, Ppidl antikoerper, Ppif antikoerper, cyp-40 antikoerper, cypd antikoerper, peptidylprolyl isomerase D antikoerper, peptidylprolyl isomerase D (cyclophilin D) antikoerper, peptidylprolyl isomerase D (cyclophilin D) S homeolog antikoerper, PPID antikoerper, Ppid antikoerper, ppid antikoerper, ppid.S antikoerper
- Hintergrund
- PPID is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- Nuclear Hormone Receptor Binding
-