MAGEB2 Antikörper (N-Term)
-
- Target Alle MAGEB2 Antikörper anzeigen
- MAGEB2 (Melanoma Antigen Family B, 2 (MAGEB2))
-
Bindungsspezifität
- N-Term
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAGEB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAGEB2 antibody was raised against the N terminal of MAGEB2
- Aufreinigung
- Affinity purified
- Immunogen
- MAGEB2 antibody was raised using the N terminal of MAGEB2 corresponding to a region with amino acids MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA
- Top Product
- Discover our top product MAGEB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAGEB2 Blocking Peptide, catalog no. 33R-6302, is also available for use as a blocking control in assays to test for specificity of this MAGEB2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAGEB2 (Melanoma Antigen Family B, 2 (MAGEB2))
- Andere Bezeichnung
- MAGEB2 (MAGEB2 Produkte)
- Synonyme
- MAGEB2 antikoerper, CT3.2 antikoerper, DAM6 antikoerper, MAGE-XP-2 antikoerper, MAGE family member B2 antikoerper, MAGEB2 antikoerper
- Hintergrund
- This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other.
- Molekulargewicht
- 35 kDa (MW of target protein)
-