PSMA4 Antikörper
-
- Target Alle PSMA4 Antikörper anzeigen
- PSMA4 (Proteasome Subunit alpha 4 (PSMA4))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSMA4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PSMA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN
- Top Product
- Discover our top product PSMA4 Primärantikörper
-
anti-Proteasome Subunit alpha 4 (PSMA4) antibody
PSMA4 Reaktivität: Human, Maus, Ratte, Affe, Hund WB, IHC, IHC (p) Wirt: Maus Monoclonal 1H10 unconjugated
anti-Proteasome Subunit alpha 4 (PSMA4) antibodyPSMA4 Reaktivität: Human, Maus, Ratte, Affe, Hund WB, IHC, IHC (p) Wirt: Maus Monoclonal 5D8 unconjugated
anti-Proteasome Subunit alpha 4 (PSMA4) antibodyPSMA4 Reaktivität: Human, Maus, Ratte, Affe WB, IHC, IHC (p) Wirt: Maus Monoclonal 4B8 unconjugated
anti-Proteasome Subunit alpha 4 (PSMA4) (AA 1-261) antibodyPSMA4 Reaktivität: Human WB, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Proteasome Subunit alpha 4 (PSMA4) (AA 1-261) antibodyPSMA4 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 2A10-E4 unconjugated
anti-Proteasome Subunit alpha 4 (PSMA4) (AA 148-184) antibodyPSMA4 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Proteasome Subunit alpha 4 (PSMA4) antibodyPSMA4 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Proteasome Subunit alpha 4 (PSMA4) antibodyPSMA4 Reaktivität: Human, Maus, Ratte, Affe IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Proteasome Subunit alpha 4 (PSMA4) (N-Term) antibodyPSMA4 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Proteasome Subunit alpha 4 (PSMA4) (Internal Region) antibodyVerified PSMA4 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Ziege Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PSMA4 Blocking Peptide, catalog no. 33R-6994, is also available for use as a blocking control in assays to test for specificity of this PSMA4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMA4 (Proteasome Subunit alpha 4 (PSMA4))
- Andere Bezeichnung
- PSMA4 (PSMA4 Produkte)
- Synonyme
- wu:fe05d10 antikoerper, zgc:56176 antikoerper, DDBDRAFT_0204055 antikoerper, DDBDRAFT_0214953 antikoerper, DDB_0204055 antikoerper, DDB_0214953 antikoerper, C9 antikoerper, HC9 antikoerper, HsT17706 antikoerper, PSC9 antikoerper, proteasome subunit alpha 4 antikoerper, proteasome subunit alpha 4 S homeolog antikoerper, proteasome subunit alpha type 4 antikoerper, 20S proteasome subunit alpha-4 antikoerper, proteasome (prosome, macropain) subunit, alpha type 4 antikoerper, psma4 antikoerper, psma4.S antikoerper, PSMA4 antikoerper, CNF01860 antikoerper, psmA4 antikoerper, Psma4 antikoerper
- Hintergrund
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-
