KIAA1191 Antikörper (Middle Region)
-
- Target Alle KIAA1191 Antikörper anzeigen
- KIAA1191
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KIAA1191 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIAA1191 antibody was raised against the middle region of KIAA1191
- Aufreinigung
- Affinity purified
- Immunogen
- KIAA1191 antibody was raised using the middle region of KIAA1191 corresponding to a region with amino acids TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP
- Top Product
- Discover our top product KIAA1191 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIAA1191 Blocking Peptide, catalog no. 33R-9222, is also available for use as a blocking control in assays to test for specificity of this KIAA1191 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1191 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIAA1191
- Andere Bezeichnung
- KIAA1191 (KIAA1191 Produkte)
- Synonyme
- p60MONOX antikoerper, 4930558H15Rik antikoerper, C81457 antikoerper, Kiaa1191 antikoerper, P33monox antikoerper, P33MONOX antikoerper, p33monox antikoerper, DKFZp469A246 antikoerper, KIAA1191 antikoerper, RIKEN cDNA 4833439L19 gene antikoerper, KIAA1191 L homeolog antikoerper, KIAA1191 ortholog antikoerper, KIAA1191 antikoerper, 4833439L19Rik antikoerper, kiaa1191.L antikoerper, kiaa1191 antikoerper, Kiaa1191 antikoerper
- Hintergrund
- The function of KIAA1191 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 33 kDa (MW of target protein)
-