ZCCHC13 Antikörper (Middle Region)

Produktnummer ABIN632852

Produktdetails anti-ZCCHC13 Antikörper

Target: ZCCHC13 (Zinc Finger, C3HC-Type Containing 13 (ZCCHC13))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZCCHC13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZCCHC13 antibody was raised against the middle region of ZCCHC13

Aufreinigung: Affinity purified

Immunogen: ZCCHC13 antibody was raised using the middle region of ZCCHC13 corresponding to a region with amino acids GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZCCHC13 Blocking Peptide, catalog no. 33R-3370, is also available for use as a blocking control in assays to test for specificity of this ZCCHC13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCCHC13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZCCHC13

Target: ZCCHC13 (Zinc Finger, C3HC-Type Containing 13 (ZCCHC13))

Andere Bezeichnung: ZCCHC13 (ZCCHC13 Produkte)

Synonyme: CNBP2 antikoerper, ZNF9L antikoerper, zinc finger CCHC-type containing 13 antikoerper, ZCCHC13 antikoerper

Hintergrund: The function of ZCCHC13 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 18 kDa (MW of target protein)