HARBI1 Antikörper (Middle Region)

Produktnummer ABIN632839

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch HARBI1 in WB. Es zeigt Reaktivität gegenüber Proben von Maus, Human und Ratte.

Kurzübersicht für HARBI1 Antikörper (Middle Region) (ABIN632839)

Target: HARBI1 (Harbinger Transposase Derived 1 (HARBI1))

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HARBI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HARBI1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C11 ORF77 antibody was raised against the middle region of C11 rf77

Aufreinigung: Affinity purified

Immunogen: C11 ORF77 antibody was raised using the middle region of C11 rf77 corresponding to a region with amino acids GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C11ORF77 Blocking Peptide, (ABIN939031), is also available for use as a blocking control in assays to test for specificity of this C11ORF77 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF77 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HARBI1

Target: HARBI1 (Harbinger Transposase Derived 1 (HARBI1))

Andere Bezeichnung: C11ORF77

Hintergrund: The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 39 kDa (MW of target protein)