HARBI1 Antikörper (Middle Region)

Produktnummer ABIN632839

Produktdetails anti-HARBI1 Antikörper

Target: HARBI1 (Harbinger Transposase Derived 1 (HARBI1))

Bindungsspezifität: Middle Region

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HARBI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C11 ORF77 antibody was raised against the middle region of C11 rf77

Aufreinigung: Affinity purified

Immunogen: C11 ORF77 antibody was raised using the middle region of C11 rf77 corresponding to a region with amino acids GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C11ORF77 Blocking Peptide, catalog no. 33R-3645, is also available for use as a blocking control in assays to test for specificity of this C11ORF77 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF77 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HARBI1

Target: HARBI1 (Harbinger Transposase Derived 1 (HARBI1))

Andere Bezeichnung: C11ORF77 (HARBI1 Produkte)

Synonyme: C11orf77 antikoerper, C15H11orf77 antikoerper, D230010M03Rik antikoerper, flj32675 antikoerper, zgc:91866 antikoerper, harbinger transposase derived 1 antikoerper, HARBI1 antikoerper, Harbi1 antikoerper, harbi1 antikoerper

Hintergrund: The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 39 kDa (MW of target protein)