HARBI1 Antikörper (Middle Region)
-
- Target Alle HARBI1 Antikörper anzeigen
- HARBI1 (Harbinger Transposase Derived 1 (HARBI1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Maus, Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HARBI1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C11 ORF77 antibody was raised against the middle region of C11 rf77
- Aufreinigung
- Affinity purified
- Immunogen
- C11 ORF77 antibody was raised using the middle region of C11 rf77 corresponding to a region with amino acids GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN
- Top Product
- Discover our top product HARBI1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C11ORF77 Blocking Peptide, catalog no. 33R-3645, is also available for use as a blocking control in assays to test for specificity of this C11ORF77 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF77 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HARBI1 (Harbinger Transposase Derived 1 (HARBI1))
- Andere Bezeichnung
- C11ORF77 (HARBI1 Produkte)
- Synonyme
- C11orf77 antikoerper, C15H11orf77 antikoerper, D230010M03Rik antikoerper, flj32675 antikoerper, zgc:91866 antikoerper, harbinger transposase derived 1 antikoerper, HARBI1 antikoerper, Harbi1 antikoerper, harbi1 antikoerper
- Hintergrund
- The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 39 kDa (MW of target protein)
-