PDZD9 Antikörper (Middle Region)

Produktnummer ABIN632838

Produktdetails anti-PDZD9 Antikörper

Target: PDZD9 (PDZ Domain Containing 9 (PDZD9))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDZD9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C16 ORF65 antibody was raised against the middle region of C16 rf65

Aufreinigung: Affinity purified

Immunogen: C16 ORF65 antibody was raised using the middle region of C16 rf65 corresponding to a region with amino acids TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C16ORF65 Blocking Peptide, catalog no. 33R-9303, is also available for use as a blocking control in assays to test for specificity of this C16ORF65 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF65 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDZD9

Target: PDZD9 (PDZ Domain Containing 9 (PDZD9))

Andere Bezeichnung: C16ORF65 (PDZD9 Produkte)

Synonyme: C16orf65 antikoerper, C25H16orf65 antikoerper, 4930408O21Rik antikoerper, LRRGT00105 antikoerper, PDZ domain containing 9 antikoerper, PDZD9 antikoerper, Pdzd9 antikoerper

Hintergrund: The function of Chromosome 16 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 23 kDa (MW of target protein)