AAMDC Antikörper (Middle Region)

Produktnummer ABIN632818

Produktdetails anti-AAMDC Antikörper

Target: AAMDC (Adipogenesis Associated Mth938 Domain Containing (AAMDC))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AAMDC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C11 ORF67 antibody was raised against the middle region of C11 rf67

Aufreinigung: Affinity purified

Immunogen: C11 ORF67 antibody was raised using the middle region of C11 rf67 corresponding to a region with amino acids SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C11ORF67 Blocking Peptide, catalog no. 33R-8383, is also available for use as a blocking control in assays to test for specificity of this C11ORF67 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF67 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AAMDC

Target: AAMDC (Adipogenesis Associated Mth938 Domain Containing (AAMDC))

Andere Bezeichnung: C11ORF67 (AAMDC Produkte)

Synonyme: C11orf67 antikoerper, C29H11orf67 antikoerper, c11orf67 antikoerper, zgc:112239 antikoerper, CK067 antikoerper, RGD1561459 antikoerper, 1810020D17Rik antikoerper, 1810037D19Rik antikoerper, LI2 antikoerper, adipogenesis associated Mth938 domain containing antikoerper, adipogenesis associated, Mth938 domain containing antikoerper, AAMDC antikoerper, aamdc antikoerper, Aamdc antikoerper

Hintergrund: The function of C11orf67 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 13 kDa (MW of target protein)