PPWD1 Antikörper (Middle Region)

Produktnummer ABIN632810

Der Kaninchen Polyklonal anti-PPWD1 Antikörper wird verwendet zum Nachweis von PPWD1 in Proben von Human, Ratte und Maus. Er wurde validiert für WB.

Kurzübersicht für PPWD1 Antikörper (Middle Region) (ABIN632810)

Target: PPWD1 (Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPWD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PPWD1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PPWD1 antibody was raised against the middle region of PPWD1

Aufreinigung: Affinity purified

Immunogen: PPWD1 antibody was raised using the middle region of PPWD1 corresponding to a region with amino acids FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPWD1 Blocking Peptide, (ABIN938384), is also available for use as a blocking control in assays to test for specificity of this PPWD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPWD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPWD1

Target: PPWD1 (Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1))

Andere Bezeichnung: PPWD1

Hintergrund: PPWD1 is a putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPWD1 may be involved in pre-mRNA splicing.

Molekulargewicht: 73 kDa (MW of target protein)