PPWD1 Antikörper (Middle Region)
-
- Target Alle PPWD1 Antikörper anzeigen
- PPWD1 (Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPWD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PPWD1 antibody was raised against the middle region of PPWD1
- Aufreinigung
- Affinity purified
- Immunogen
- PPWD1 antibody was raised using the middle region of PPWD1 corresponding to a region with amino acids FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG
- Top Product
- Discover our top product PPWD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPWD1 Blocking Peptide, catalog no. 33R-2998, is also available for use as a blocking control in assays to test for specificity of this PPWD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPWD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPWD1 (Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1))
- Andere Bezeichnung
- PPWD1 (PPWD1 Produkte)
- Synonyme
- zgc:165355 antikoerper, 4632422M10Rik antikoerper, A330090G21Rik antikoerper, RGD1310204 antikoerper, peptidylprolyl isomerase domain and WD repeat containing 1 antikoerper, peptidylprolyl isomerase domain and WD repeat containing 1 S homeolog antikoerper, PPWD1 antikoerper, ppwd1 antikoerper, ppwd1.S antikoerper, Ppwd1 antikoerper
- Hintergrund
- PPWD1 is a putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPWD1 may be involved in pre-mRNA splicing.
- Molekulargewicht
- 73 kDa (MW of target protein)
-