SMG5 Antikörper

Produktnummer ABIN632808

Produktdetails anti-SMG5 Antikörper

Target: SMG5 (Smg-5 Homolog, Nonsense Mediated mRNA Decay Factor (SMG5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMG5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SMG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMG5 Blocking Peptide, catalog no. 33R-6479, is also available for use as a blocking control in assays to test for specificity of this SMG5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMG5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMG5

Target: SMG5 (Smg-5 Homolog, Nonsense Mediated mRNA Decay Factor (SMG5))

Andere Bezeichnung: SMG5 (SMG5 Produkte)

Synonyme: BC024683 antikoerper, mKIAA1089 antikoerper, EST1B antikoerper, LPTS-RP1 antikoerper, LPTSRP1 antikoerper, SMG-5 antikoerper, SMG5, nonsense mediated mRNA decay factor antikoerper, Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans) antikoerper, SMG5 nonsense mediated mRNA decay factor antikoerper, SMG5 antikoerper, Smg5 antikoerper

Hintergrund: SMG5 plays a role in nonsense-mediated mRNA decay. SMG5 does not have RNase activity by itself. SMG5 promotes dephosphorylation of RENT1. SMG5 is necessary for TERT activity.

Molekulargewicht: 114 kDa (MW of target protein)