HSPE1 Antikörper

Produktnummer ABIN632792

Produktdetails anti-HSPE1 Antikörper

Target: HSPE1 (Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HSPE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPE1 Blocking Peptide, catalog no. 33R-3360, is also available for use as a blocking control in assays to test for specificity of this HSPE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSPE1

Target: HSPE1 (Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1))

Andere Bezeichnung: HSPE1 (HSPE1 Produkte)

Synonyme: CPN10 antikoerper, EPF antikoerper, GROES antikoerper, HSP10 antikoerper, groS antikoerper, Cpn10 antikoerper, cpn10 antikoerper, zgc:86747 antikoerper, hspe1 antikoerper, MGC89647 antikoerper, HSPE1 antikoerper, MITOCHONDRIAL CHAPERONIN 10 antikoerper, T15D22.2 antikoerper, T15D22_2 antikoerper, chaperonin 10 antikoerper, Dmel\\CG11267 antikoerper, Hsp10 antikoerper, anon-WO0118547.175 antikoerper, hsp10 antikoerper, crpB antikoerper, chpS antikoerper, 10kDa antikoerper, mt-cpn10 antikoerper, heat shock protein family E (Hsp10) member 1 antikoerper, molecular chaperone GroES antikoerper, chaperonin 10 kDa antikoerper, chaperonin, 10 kDa antikoerper, chaperonin-10 kDa antikoerper, heat shock protein family E member 1 antikoerper, heat shock 10 protein 1 antikoerper, heat shock protein family E (Hsp10) member 1 L homeolog antikoerper, heat shock 10kDa protein 1 (chaperonin 10) pseudogene antikoerper, 10 kd chaperonin antikoerper, chaperonin 10 antikoerper, Hsp10p antikoerper, co-chaperonin 10, mitochondrial antikoerper, CG11267 gene product from transcript CG11267-RA antikoerper, co-chaperonin GroES antikoerper, mitochondrial heat shock protein Hsp10 (predicted) antikoerper, chaperonin GroS antikoerper, Hsp10 10 kDa chaperonin GROES antikoerper, mitochondrial heat shock protein Hsp10 antikoerper, heat shock protein 10 antikoerper, heat shock protein 1 (chaperonin 10) antikoerper, heat shock 10kDa protein 1 (chaperonin 10) antikoerper, HSPE1 antikoerper, groES antikoerper, groES2 antikoerper, TP01_0190 antikoerper, Cag_1167 antikoerper, Bm1_56470 antikoerper, Hspe1 antikoerper, hspe1 antikoerper, hspe1.L antikoerper, LOC452179 antikoerper, Cpn10 antikoerper, CPN10 antikoerper, HSP10 antikoerper, CG11267 antikoerper, hsp10 antikoerper, groS antikoerper

Hintergrund: HSPE1 is a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner.

Molekulargewicht: 11 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity