HSPE1 Antikörper

Produktnummer ABIN632792

Der Kaninchen Polyklonal anti-HSPE1 Antikörper wird verwendet zum Nachweis von HSPE1 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für HSPE1 Antikörper (ABIN632792)

Target: HSPE1 (Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HSPE1 Antikörper

Aufreinigung: Affinity purified

Immunogen: HSPE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPE1 Blocking Peptide, (ABIN938746), is also available for use as a blocking control in assays to test for specificity of this HSPE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSPE1

Target: HSPE1 (Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1))

Andere Bezeichnung: HSPE1

Hintergrund: HSPE1 is a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner.

Molekulargewicht: 11 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity