RAB3IP Antikörper

Produktnummer ABIN632769

Produktdetails anti-RAB3IP Antikörper

Target: RAB3IP (RAB3A Interacting Protein (Rabin3) (RAB3IP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB3IP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RAB3 IP antibody was raised using a synthetic peptide corresponding to a region with amino acids APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB3IP Blocking Peptide, catalog no. 33R-1417, is also available for use as a blocking control in assays to test for specificity of this RAB3IP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 P antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB3IP

Target: RAB3IP (RAB3A Interacting Protein (Rabin3) (RAB3IP))

Andere Bezeichnung: RAB3IP (RAB3IP Produkte)

Synonyme: rabin3 antikoerper, gtpat12 antikoerper, MGC64583 antikoerper, MGC75737 antikoerper, MGC82752 antikoerper, zgc:110270 antikoerper, DKFZp469A0532 antikoerper, DKFZp469O1131 antikoerper, RABIN3 antikoerper, B230311A06 antikoerper, Gtpat12 antikoerper, Rabin3 antikoerper, RAB3A interacting protein L homeolog antikoerper, RAB3A interacting protein antikoerper, RAB3A interacting protein (rabin3) antikoerper, rab3ip.L antikoerper, rab3ip antikoerper, RAB3IP antikoerper, Rab3ip antikoerper

Hintergrund: The function of RAB3A protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 53 kDa (MW of target protein)