RAB3IP Antikörper

Produktnummer ABIN632769

Der Kaninchen Polyklonal anti-RAB3IP Antikörper (ABIN632769) detektiert spezifisch RAB3IP in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für RAB3IP Antikörper (ABIN632769)

Target: RAB3IP (RAB3A Interacting Protein (Rabin3) (RAB3IP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB3IP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAB3IP Antikörper

Aufreinigung: Affinity purified

Immunogen: RAB3 IP antibody was raised using a synthetic peptide corresponding to a region with amino acids APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB3IP Blocking Peptide, (ABIN936803), is also available for use as a blocking control in assays to test for specificity of this RAB3IP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 P antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB3IP

Target: RAB3IP (RAB3A Interacting Protein (Rabin3) (RAB3IP))

Andere Bezeichnung: RAB3IP

Hintergrund: The function of RAB3A protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 53 kDa (MW of target protein)