CCDC151 Antikörper (Middle Region)

Produktnummer ABIN632726

Produktdetails anti-CCDC151 Antikörper

Target: CCDC151 (Coiled-Coil Domain Containing 151 (CCDC151))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC151 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MGC20983 antibody was raised against the middle region of Mgc20983

Aufreinigung: Affinity purified

Immunogen: MGC20983 antibody was raised using the middle region of Mgc20983 corresponding to a region with amino acids IALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGC20983 Blocking Peptide, catalog no. 33R-3894, is also available for use as a blocking control in assays to test for specificity of this MGC20983 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC20983 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC151

Target: CCDC151 (Coiled-Coil Domain Containing 151 (CCDC151))

Andere Bezeichnung: MGC20983 (CCDC151 Produkte)

Synonyme: AI644415 antikoerper, C330001K17Rik antikoerper, coiled-coil domain containing 151 antikoerper, CCDC151 antikoerper, Ccdc151 antikoerper

Hintergrund: The function of the MGC20983 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 69 kDa (MW of target protein)