SERPINB1 Antikörper
-
- Target Alle SERPINB1 Antikörper anzeigen
- SERPINB1 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SERPINB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SERPINB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENL
- Top Product
- Discover our top product SERPINB1 Primärantikörper
-
anti-serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1) (AA 184-368) antibody
SERPINB1 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1) (AA 17-332) antibodySERPINB1 Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1) (AA 1-379) antibodySERPINB1 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1) (AA 77-306) antibodySERPINB1 Reaktivität: Human, Ratte, Affe, Hund WB, IHC, FACS, IHC (p) Wirt: Maus Monoclonal 3B4 unconjugated
anti-serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1) (AA 77-306) antibodySERPINB1 Reaktivität: Human, Ratte, Hund WB, IHC, FACS, IHC (p) Wirt: Maus Monoclonal 4B3 unconjugated
anti-serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1) (AA 1-379) antibodySERPINB1 Reaktivität: Human WB, ELISA, IHC, IP, IF Wirt: Kaninchen Polyclonal unconjugated
anti-serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1) (AA 201-300) antibodySERPINB1 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 4D7 unconjugated
anti-serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1) (AA 100-379) antibodySERPINB1 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1) (AA 100-379) antibodySERPINB1 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1) (AA 1-379) antibodySERPINB1 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SERPINB1 Blocking Peptide, catalog no. 33R-8251, is also available for use as a blocking control in assays to test for specificity of this SERPINB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SERPINB1 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1))
- Andere Bezeichnung
- SERPINB1 (SERPINB1 Produkte)
- Synonyme
- ELANH2 antikoerper, zgc:91981 antikoerper, si:dkey-177p2.11 antikoerper, si:dkey-177p2.12 antikoerper, EI antikoerper, LEI antikoerper, M/NEI antikoerper, MNEI antikoerper, PI-2 antikoerper, PI2 antikoerper, elanh2 antikoerper, lei antikoerper, m/nei antikoerper, mnei antikoerper, pi2 antikoerper, serpin peptidase inhibitor, clade B (ovalbumin), member 1 antikoerper, serpin family B member 1 antikoerper, serpin family B member 1 L homeolog antikoerper, SERPINB1 antikoerper, serpinb1 antikoerper, serpinb1.L antikoerper
- Hintergrund
- SERPINB1 regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3.
- Molekulargewicht
- 43 kDa (MW of target protein)
-
