CELA1 Antikörper (N-Term)

Produktnummer ABIN632696

Der Kaninchen Polyklonal anti-CELA1 Antikörper wird verwendet zum Nachweis von CELA1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CELA1 Antikörper (N-Term) (ABIN632696)

Target: CELA1 (Chymotrypsin-Like Elastase Family, Member 1 (CELA1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CELA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CELA1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Elastase 1 antibody (Pancreatic) was raised against the N terminal of ELA1

Aufreinigung: Affinity purified

Immunogen: Elastase 1 antibody (Pancreatic) was raised using the N terminal of ELA1 corresponding to a region with amino acids LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Elastase 1 Blocking Peptide (Pancreatic), (ABIN5613355), is also available for use as a blocking control in assays to test for specificity of this Elastase 1 antibody (Pancreatic)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CELA1

Target: CELA1 (Chymotrypsin-Like Elastase Family, Member 1 (CELA1))

Andere Bezeichnung: Elastase 1

Hintergrund: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 (ELA1) expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas is actually referring to elastase 2A.

Molekulargewicht: 28 kDa (MW of target protein)