CELA1 Antikörper (N-Term)

Produktnummer ABIN632696

Produktdetails anti-CELA1 Antikörper

Target: CELA1 (Chymotrypsin-Like Elastase Family, Member 1 (CELA1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CELA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Elastase 1 antibody (Pancreatic) was raised against the N terminal of ELA1

Aufreinigung: Affinity purified

Immunogen: Elastase 1 antibody (Pancreatic) was raised using the N terminal of ELA1 corresponding to a region with amino acids LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Elastase 1 Blocking Peptide (Pancreatic), catalog no. 33R-5528, is also available for use as a blocking control in assays to test for specificity of this Elastase 1 antibody (Pancreatic)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CELA1

Target: CELA1 (Chymotrypsin-Like Elastase Family, Member 1 (CELA1))

Andere Bezeichnung: Elastase 1 (CELA1 Produkte)

Synonyme: ELA1 antikoerper, 1810009A17Rik antikoerper, 1810062B19Rik antikoerper, Ela-1 antikoerper, Ela1 antikoerper, PC-TsF antikoerper, ela1 antikoerper, ELS1 antikoerper, Elastase-1 antikoerper, ELAI1 antikoerper, RATELAI1 antikoerper, chymotrypsin like elastase family member 1 antikoerper, chymotrypsin-like elastase family, member 1 antikoerper, CELA1 antikoerper, Cela1 antikoerper, cela1 antikoerper

Hintergrund: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 (ELA1) expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas is actually referring to elastase 2A.

Molekulargewicht: 28 kDa (MW of target protein)