PM20D2 Antikörper (Middle Region)

Produktnummer ABIN632689

Produktdetails anti-PM20D2 Antikörper

Target: PM20D2 (Peptidase M20 Domain Containing 2 (PM20D2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PM20D2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PM20 D2 antibody was raised against the middle region of PM20 2

Aufreinigung: Affinity purified

Immunogen: PM20 D2 antibody was raised using the middle region of PM20 2 corresponding to a region with amino acids HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALAS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PM20D2 Blocking Peptide, catalog no. 33R-3738, is also available for use as a blocking control in assays to test for specificity of this PM20D2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PM20 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PM20D2

Target: PM20D2 (Peptidase M20 Domain Containing 2 (PM20D2))

Andere Bezeichnung: PM20D2 (PM20D2 Produkte)

Synonyme: ACY1L2 antikoerper, bA63L7.3 antikoerper, Acy1l2 antikoerper, Gm424 antikoerper, peptidase M20 domain containing 2 antikoerper, PM20D2 antikoerper, Pm20d2 antikoerper

Hintergrund: PM20D2 belongs to the peptidase M20A family. The function of PM20D2 remains unknown.

Molekulargewicht: 48 kDa (MW of target protein)