PGAM2 Antikörper

Produktnummer ABIN632675

Der Kaninchen Polyklonal anti-PGAM2 Antikörper wird verwendet zum Nachweis von PGAM2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für PGAM2 Antikörper (ABIN632675)

Target: PGAM2 (phosphoglycerate Mutase 2 (Muscle) (PGAM2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PGAM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PGAM2 Antikörper

Aufreinigung: Affinity purified

Immunogen: PGAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PGAM2 Blocking Peptide, (ABIN5615328), is also available for use as a blocking control in assays to test for specificity of this PGAM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGAM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PGAM2

Target: PGAM2 (phosphoglycerate Mutase 2 (Muscle) (PGAM2))

Andere Bezeichnung: PGAM2

Hintergrund: PGAM2 is the interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. It can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.

Molekulargewicht: 29 kDa (MW of target protein)