PGAM2 Antikörper
-
- Target Alle PGAM2 Antikörper anzeigen
- PGAM2 (phosphoglycerate Mutase 2 (Muscle) (PGAM2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PGAM2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PGAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKM
- Top Product
- Discover our top product PGAM2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PGAM2 Blocking Peptide, catalog no. 33R-5774, is also available for use as a blocking control in assays to test for specificity of this PGAM2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGAM2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PGAM2 (phosphoglycerate Mutase 2 (Muscle) (PGAM2))
- Andere Bezeichnung
- PGAM2 (PGAM2 Produkte)
- Synonyme
- zgc:63876 antikoerper, GSD10 antikoerper, PGAM-M antikoerper, PGAMM antikoerper, D14Mgh1 antikoerper, Pgmut antikoerper, phosphoglycerate mutase 2 antikoerper, phosphoglycerate mutase 2 (muscle) antikoerper, phosphoglycerate mutase 2 L homeolog antikoerper, Pgam2 antikoerper, PGAM2 antikoerper, pgam2 antikoerper, pgam2.L antikoerper
- Hintergrund
- PGAM2 is the interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. It can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
- Molekulargewicht
- 29 kDa (MW of target protein)
-