C2orf47 Antikörper (Middle Region)

Produktnummer ABIN632673

Produktdetails anti-C2orf47 Antikörper

Target: C2orf47 (Chromosome 2 Open Reading Frame 47 (C2orf47))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C2orf47 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C2 ORF47 antibody was raised against the middle region of C2 rf47

Aufreinigung: Affinity purified

Immunogen: C2 ORF47 antibody was raised using the middle region of C2 rf47 corresponding to a region with amino acids GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C2ORF47 Blocking Peptide, catalog no. 33R-3173, is also available for use as a blocking control in assays to test for specificity of this C2ORF47 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF47 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C2orf47

Target: C2orf47 (Chromosome 2 Open Reading Frame 47 (C2orf47))

Andere Bezeichnung: C2ORF47 (C2orf47 Produkte)

Synonyme: C12H2orf47 antikoerper, C2orf47 antikoerper, chromosome 7 open reading frame, human C2orf47 antikoerper, matrix AAA peptidase interacting protein 1 antikoerper, matrix AAA peptidase interacting protein 1 L homeolog antikoerper, C7H2ORF47 antikoerper, MAIP1 antikoerper, maip1 antikoerper, maip1.L antikoerper

Hintergrund: The function of the C2orf47 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 32 kDa (MW of target protein)