CNDP2 Antikörper

Produktnummer ABIN632658

Produktdetails anti-CNDP2 Antikörper

Target: CNDP2 (CNDP Dipeptidase 2 (Metallopeptidase M20 Family) (CNDP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CNDP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CNDP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CNDP2 Blocking Peptide, catalog no. 33R-1325, is also available for use as a blocking control in assays to test for specificity of this CNDP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNDP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CNDP2

Target: CNDP2 (CNDP Dipeptidase 2 (Metallopeptidase M20 Family) (CNDP2))

Andere Bezeichnung: CNDP2 (CNDP2 Produkte)

Synonyme: 0610010E05Rik antikoerper, C76600 antikoerper, Cn2 antikoerper, Dip-2 antikoerper, Pep-1 antikoerper, Pep1 antikoerper, CN2 antikoerper, CPGL antikoerper, HsT2298 antikoerper, PEPA antikoerper, cn2 antikoerper, cpgl antikoerper, darmin-r antikoerper, CNDP2 antikoerper, zgc:92569 antikoerper, wu:fd20d11 antikoerper, wu:fe17f09 antikoerper, cndp2b antikoerper, PEPC1 antikoerper, PEPCase antikoerper, PPC1 antikoerper, PPEPC4 antikoerper, pepc antikoerper, carnosine dipeptidase 2 antikoerper, CNDP dipeptidase 2 (metallopeptidase M20 family) antikoerper, CNDP dipeptidase 2 (metallopeptidase M20 family) S homeolog antikoerper, CNDP dipeptidase 2 (metallopeptidase M20 family) L homeolog antikoerper, phosphoenolpyruvate carboxylase 1 antikoerper, Cndp2 antikoerper, CNDP2 antikoerper, cndp2 antikoerper, cndp2.S antikoerper, cndp2.L antikoerper, pep1 antikoerper

Hintergrund: CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase.

Molekulargewicht: 53 kDa (MW of target protein)