DHFRL1 Antikörper (Middle Region)

Produktnummer ABIN632654

Produktdetails anti-DHFRL1 Antikörper

Target: DHFRL1 (Dihydrofolate Reductase-Like 1 (DHFRL1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHFRL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DHFRL1 antibody was raised against the middle region of DHFRL1

Aufreinigung: Affinity purified

Immunogen: DHFRL1 antibody was raised using the middle region of DHFRL1 corresponding to a region with amino acids RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHFRL1 Blocking Peptide, catalog no. 33R-7973, is also available for use as a blocking control in assays to test for specificity of this DHFRL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHFRL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHFRL1

Target: DHFRL1 (Dihydrofolate Reductase-Like 1 (DHFRL1))

Andere Bezeichnung: DHFRL1 (DHFRL1 Produkte)

Synonyme: DHFRP4 antikoerper, dihydrofolate reductase 2 antikoerper, DHFR2 antikoerper

Hintergrund: DHFRL1 may play a role in folate metabolism.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process