GAN Antikörper (Middle Region)
-
- Target Alle GAN Antikörper anzeigen
- GAN (Gigaxonin (GAN))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GAN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GAN antibody was raised against the middle region of GAN
- Aufreinigung
- Affinity purified
- Immunogen
- GAN antibody was raised using the middle region of GAN corresponding to a region with amino acids IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG
- Top Product
- Discover our top product GAN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GAN Blocking Peptide, catalog no. 33R-4223, is also available for use as a blocking control in assays to test for specificity of this GAN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GAN (Gigaxonin (GAN))
- Andere Bezeichnung
- GAN (GAN Produkte)
- Synonyme
- MGC81691 antikoerper, GAN antikoerper, A330045G18 antikoerper, gigaxonin antikoerper, GAN1 antikoerper, KLHL16 antikoerper, gigaxonin L homeolog antikoerper, gigaxonin antikoerper, giant axonal neuropathy antikoerper, gan.L antikoerper, gan antikoerper, GAN antikoerper, Gan antikoerper
- Hintergrund
- This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).
- Molekulargewicht
- 66 kDa (MW of target protein)
-