REM1 Antikörper

Produktnummer ABIN632639

Produktdetails anti-REM1 Antikörper

Target: REM1 (RAS (RAD and GEM)-Like GTP-Binding 1 (REM1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser REM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: REM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

REM1 Blocking Peptide, catalog no. 33R-8372, is also available for use as a blocking control in assays to test for specificity of this REM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu REM1

Target: REM1 (RAS (RAD and GEM)-Like GTP-Binding 1 (REM1))

Andere Bezeichnung: REM1 (REM1 Produkte)

Synonyme: GD:REM antikoerper, GES antikoerper, E030011C07Rik antikoerper, Rem antikoerper, GEM antikoerper, SI:zK76P14.3 antikoerper, horizin antikoerper, rem antikoerper, zgc:56144 antikoerper, RRAD and GEM like GTPase 1 antikoerper, rad and gem related GTP binding protein 1 antikoerper, RAS (RAD and GEM)-like GTP-binding 1 antikoerper, REM1 antikoerper, Rem1 antikoerper, rem1 antikoerper

Hintergrund: The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.

Molekulargewicht: 33 kDa (MW of target protein)