OSCP1 Antikörper (N-Term)
-
- Target Alle OSCP1 Antikörper anzeigen
- OSCP1 (Organic Solute Carrier Partner 1 (OSCP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OSCP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C1 orf102 antibody was raised against the N terminal of C1 rf102
- Aufreinigung
- Affinity purified
- Immunogen
- C1 orf102 antibody was raised using the N terminal of C1 rf102 corresponding to a region with amino acids ARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQ
- Top Product
- Discover our top product OSCP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C1orf102 Blocking Peptide, catalog no. 33R-1480, is also available for use as a blocking control in assays to test for specificity of this C1orf102 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf102 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OSCP1 (Organic Solute Carrier Partner 1 (OSCP1))
- Andere Bezeichnung
- C1orf102 (OSCP1 Produkte)
- Synonyme
- nor1 antikoerper, oscp1 antikoerper, zgc:171454 antikoerper, 1810007P19Rik antikoerper, 5730415O04 antikoerper, 6030436A01Rik antikoerper, RGD1306596 antikoerper, C1orf102 antikoerper, NOR1 antikoerper, organic solute carrier partner 1 antikoerper, organic solute carrier partner 1 L homeolog antikoerper, organic solute carrier partner 1a antikoerper, OSCP1 antikoerper, oscp1 antikoerper, oscp1.L antikoerper, oscp1a antikoerper, Oscp1 antikoerper
- Hintergrund
- The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 26 kDa (MW of target protein)
-