C3orf33 Antikörper (Middle Region)

Produktnummer ABIN632605

Produktdetails anti-C3orf33 Antikörper

Target: C3orf33 (Chromosome 3 Open Reading Frame 33 (C3orf33))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C3orf33 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C3 orf33 antibody was raised against the middle region of C3 rf33

Aufreinigung: Affinity purified

Immunogen: C3 orf33 antibody was raised using the middle region of C3 rf33 corresponding to a region with amino acids NSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C3orf33 Blocking Peptide, catalog no. 33R-6869, is also available for use as a blocking control in assays to test for specificity of this C3orf33 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf33 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C3orf33

Target: C3orf33 (Chromosome 3 Open Reading Frame 33 (C3orf33))

Andere Bezeichnung: C3orf33 (C3orf33 Produkte)

Synonyme: AC3-33 antikoerper, MGC99235 antikoerper, chromosome 3 open reading frame 33 antikoerper, chromosome 3 open reading frame 33 L homeolog antikoerper, RIKEN cDNA E130311K13 gene antikoerper, C3orf33 antikoerper, c3orf33.L antikoerper, E130311K13Rik antikoerper

Hintergrund: The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 29 kDa (MW of target protein)