RHOB Antikörper (Middle Region)

Produktnummer ABIN632603

Der Kaninchen Polyklonal anti-RHOB Antikörper wird verwendet zum Nachweis von RHOB in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für RHOB Antikörper (Middle Region) (ABIN632603)

Target: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHOB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RHOB Antikörper

Bindungsspezifität: Middle Region

Spezifität: RHOB antibody was raised against the middle region of RHOB

Aufreinigung: Affinity purified

Immunogen: RHOB antibody was raised using the middle region of RHOB corresponding to a region with amino acids CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHOB Blocking Peptide, (ABIN937155), is also available for use as a blocking control in assays to test for specificity of this RHOB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHOB

Target: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Andere Bezeichnung: RHOB

Hintergrund: RHOB mediates apoptosis in neoplastically transformed cells after DNA damage.RHOB is not essential for development but affects cell adhesion and growth factor signaling in transformed cells.RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. RHOB is involved in intracellular protein trafficking of a number of proteins.RHOB targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes.

Molekulargewicht: 22 kDa (MW of target protein)