RHOB Antikörper (Middle Region)

Produktnummer ABIN632603

Produktdetails anti-RHOB Antikörper

Target: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHOB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RHOB antibody was raised against the middle region of RHOB

Aufreinigung: Affinity purified

Immunogen: RHOB antibody was raised using the middle region of RHOB corresponding to a region with amino acids CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHOB Blocking Peptide, catalog no. 33R-1769, is also available for use as a blocking control in assays to test for specificity of this RHOB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHOB

Target: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Andere Bezeichnung: RHOB (RHOB Produkte)

Synonyme: ARH6 antikoerper, ARHB antikoerper, MST081 antikoerper, MSTP081 antikoerper, RHOH6 antikoerper, AA017882 antikoerper, Arh6 antikoerper, Arhb antikoerper, RHO antikoerper, arha antikoerper, rhoa antikoerper, wu:fj42e08 antikoerper, zgc:92206 antikoerper, rhob antikoerper, xrhob antikoerper, ras homolog family member B antikoerper, ras homolog gene family, member Ab antikoerper, ras homolog family member B S homeolog antikoerper, RHOB antikoerper, Rhob antikoerper, rhoab antikoerper, rhob.S antikoerper

Hintergrund: RHOB mediates apoptosis in neoplastically transformed cells after DNA damage.RHOB is not essential for development but affects cell adhesion and growth factor signaling in transformed cells.RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. RHOB is involved in intracellular protein trafficking of a number of proteins.RHOB targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes.

Molekulargewicht: 22 kDa (MW of target protein)