PDYN Antikörper (Middle Region)

Produktnummer ABIN632594

Produktdetails anti-PDYN Antikörper

Target: PDYN (Prodynorphin (PDYN))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDYN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Prodynorphin antibody was raised against the middle region of PDYN

Aufreinigung: Affinity purified

Immunogen: Prodynorphin antibody was raised using the middle region of PDYN corresponding to a region with amino acids SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Prodynorphin Blocking Peptide, catalog no. 33R-8391, is also available for use as a blocking control in assays to test for specificity of this Prodynorphin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDYN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDYN

Target: PDYN (Prodynorphin (PDYN))

Andere Bezeichnung: Prodynorphin (PDYN Produkte)

Synonyme: pdyn antikoerper, ADCA antikoerper, PENKB antikoerper, SCA23 antikoerper, Dyn antikoerper, OLPB antikoerper, olpa antikoerper, XOLPA antikoerper, penkb antikoerper, Xen-dorphin antikoerper, olpb antikoerper, XOLPB antikoerper, wu:fj38c03 antikoerper, PDYN antikoerper, prodynorphin antikoerper, prodynorphin L homeolog antikoerper, prodynorphin S homeolog antikoerper, pdyn antikoerper, PDYN antikoerper, Pdyn antikoerper, pdyn.L antikoerper, pdyn.S antikoerper

Hintergrund: The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Molekulargewicht: 27 kDa (MW of target protein)