TGDS Antikörper (Middle Region)

Produktnummer ABIN632577

Produktdetails anti-TGDS Antikörper

Target: TGDS (TDP-Glucose 4,6-Dehydratase (TGDS))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TGDS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TGDS antibody was raised against the middle region of TGDS

Aufreinigung: Affinity purified

Immunogen: TGDS antibody was raised using the middle region of TGDS corresponding to a region with amino acids DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TGDS Blocking Peptide, catalog no. 33R-1924, is also available for use as a blocking control in assays to test for specificity of this TGDS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGDS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TGDS

Target: TGDS (TDP-Glucose 4,6-Dehydratase (TGDS))

Andere Bezeichnung: TGDS (TGDS Produkte)

Synonyme: SDR2E1 antikoerper, TDPGD antikoerper, 2610017J16Rik antikoerper, 2610025M23Rik antikoerper, AI648925 antikoerper, TDP-glucose 4,6-dehydratase antikoerper, TGDS antikoerper, Tgds antikoerper

Hintergrund: The function of TGDS protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 40 kDa (MW of target protein)