C1orf104 Antikörper (Middle Region)

Produktnummer ABIN632571

Produktdetails anti-C1orf104 Antikörper

Target: C1orf104 (Chromosome 1 Open Reading Frame 104 (C1orf104))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1orf104 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 orf104 antibody was raised against the middle region of C1 rf104

Aufreinigung: Affinity purified

Immunogen: C1 orf104 antibody was raised using the middle region of C1 rf104 corresponding to a region with amino acids APLSCPAPRAQVHRSTPMGRALLTRVLLEPLRPWACPRLPRSPPGGAQSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1orf104 Blocking Peptide, catalog no. 33R-1428, is also available for use as a blocking control in assays to test for specificity of this C1orf104 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf104 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1orf104

Target: C1orf104 (Chromosome 1 Open Reading Frame 104 (C1orf104))

Andere Bezeichnung: C1orf104 (C1orf104 Produkte)

Synonyme: C1orf104 antikoerper, RP11-21N7.3 antikoerper, RUSC1 antisense RNA 1 antikoerper, RUSC1-AS1 antikoerper

Hintergrund: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 24 kDa (MW of target protein)