PNMA-Like 1 Antikörper (Middle Region)

Produktnummer ABIN632561

Produktdetails anti-PNMA-Like 1 Antikörper

Target: PNMA-Like 1 (PNMAL1)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNMA-Like 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PNMAL1 antibody was raised against the middle region of PNMAL1

Aufreinigung: Affinity purified

Immunogen: PNMAL1 antibody was raised using the middle region of PNMAL1 corresponding to a region with amino acids APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNMAL1 Blocking Peptide, catalog no. 33R-1430, is also available for use as a blocking control in assays to test for specificity of this PNMAL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMAL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNMA-Like 1

Target: PNMA-Like 1 (PNMAL1)

Andere Bezeichnung: PNMAL1 (PNMAL1 Produkte)

Synonyme: RGD1310803 antikoerper, DKFZp459A1032 antikoerper, DKFZp459P0514 antikoerper, 0710005I19Rik antikoerper, paraneoplastic Ma antigen family member 8A antikoerper, PNMA family member 8A antikoerper, PNMA-like 1 antikoerper, Pnma8a antikoerper, PNMA8A antikoerper, PNMAL1 antikoerper, Pnmal1 antikoerper

Hintergrund: The function of PNMAL1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 48 kDa (MW of target protein)