CRTAC1 Antikörper (N-Term)

Produktnummer ABIN632560

Produktdetails anti-CRTAC1 Antikörper

Target: CRTAC1 (Cartilage Acidic Protein 1 (CRTAC1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRTAC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CRTAC1 antibody was raised against the N terminal of CRTAC1

Aufreinigung: Affinity purified

Immunogen: CRTAC1 antibody was raised using the N terminal of CRTAC1 corresponding to a region with amino acids FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CRTAC1 Blocking Peptide, catalog no. 33R-3085, is also available for use as a blocking control in assays to test for specificity of this CRTAC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRTAC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRTAC1

Target: CRTAC1 (Cartilage Acidic Protein 1 (CRTAC1))

Andere Bezeichnung: CRTAC1 (CRTAC1 Produkte)

Synonyme: ASPIP antikoerper, cb184 antikoerper, crtac1 antikoerper, sb:cb184 antikoerper, zgc:165343 antikoerper, aspic1 antikoerper, cep-68 antikoerper, MGC146658 antikoerper, ASPIC antikoerper, ASPIC1 antikoerper, CEP-68 antikoerper, 2810454P21Rik antikoerper, AW047536 antikoerper, Crtac1B antikoerper, Lotus antikoerper, W307 antikoerper, cartilage acidic protein 1 antikoerper, cartilage acidic protein 1a antikoerper, CRTAC1 antikoerper, crtac1a antikoerper, crtac1 antikoerper, aspip antikoerper, Crtac1 antikoerper

Hintergrund: The function of CRTAC protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 71 kDa (MW of target protein)