CRTAC1 Antikörper (N-Term)
-
- Target Alle CRTAC1 Antikörper anzeigen
- CRTAC1 (Cartilage Acidic Protein 1 (CRTAC1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CRTAC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CRTAC1 antibody was raised against the N terminal of CRTAC1
- Aufreinigung
- Affinity purified
- Immunogen
- CRTAC1 antibody was raised using the N terminal of CRTAC1 corresponding to a region with amino acids FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK
- Top Product
- Discover our top product CRTAC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CRTAC1 Blocking Peptide, catalog no. 33R-3085, is also available for use as a blocking control in assays to test for specificity of this CRTAC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRTAC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRTAC1 (Cartilage Acidic Protein 1 (CRTAC1))
- Andere Bezeichnung
- CRTAC1 (CRTAC1 Produkte)
- Synonyme
- ASPIP antikoerper, cb184 antikoerper, crtac1 antikoerper, sb:cb184 antikoerper, zgc:165343 antikoerper, aspic1 antikoerper, cep-68 antikoerper, MGC146658 antikoerper, ASPIC antikoerper, ASPIC1 antikoerper, CEP-68 antikoerper, 2810454P21Rik antikoerper, AW047536 antikoerper, Crtac1B antikoerper, Lotus antikoerper, W307 antikoerper, cartilage acidic protein 1 antikoerper, cartilage acidic protein 1a antikoerper, CRTAC1 antikoerper, crtac1a antikoerper, crtac1 antikoerper, aspip antikoerper, Crtac1 antikoerper
- Hintergrund
- The function of CRTAC protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 71 kDa (MW of target protein)
-