SRR Antikörper (Middle Region)
-
- Target Alle SRR Antikörper anzeigen
- SRR (Serine Racemase (SRR))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SRR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SRR antibody was raised against the middle region of SRR
- Aufreinigung
- Affinity purified
- Immunogen
- SRR antibody was raised using the middle region of SRR corresponding to a region with amino acids GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ
- Top Product
- Discover our top product SRR Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SRR Blocking Peptide, catalog no. 33R-3639, is also available for use as a blocking control in assays to test for specificity of this SRR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRR (Serine Racemase (SRR))
- Andere Bezeichnung
- SRR (SRR Produkte)
- Synonyme
- DDBDRAFT_0188432 antikoerper, DDBDRAFT_0230209 antikoerper, DDB_0188432 antikoerper, DDB_0230209 antikoerper, ilv1 antikoerper, iso1 antikoerper, ILV1 antikoerper, ISO1 antikoerper, Srs antikoerper, serine racemase antikoerper, Serine racemase antikoerper, SRR antikoerper, srr antikoerper, NGR_b19540 antikoerper, ZPR_3642 antikoerper, MGYG_07950 antikoerper, Halhy_2637 antikoerper, Runsl_3290 antikoerper, Srr antikoerper
- Hintergrund
- SRR catalyzes the synthesis of D-serine from L-serine.
- Molekulargewicht
- 36 kDa (MW of target protein)
-