DNAJC12 Antikörper

Produktnummer ABIN632555

Produktdetails anti-DNAJC12 Antikörper

Target: DNAJC12 (DnaJ (Hsp40) Homolog, Subfamily C, Member 12 (DNAJC12))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNAJC12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DNAJC12 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNAJC12 Blocking Peptide, catalog no. 33R-2668, is also available for use as a blocking control in assays to test for specificity of this DNAJC12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNAJC12

Target: DNAJC12 (DnaJ (Hsp40) Homolog, Subfamily C, Member 12 (DNAJC12))

Andere Bezeichnung: DNAJC12 (DNAJC12 Produkte)

Synonyme: DNAJC12 antikoerper, JDP1 antikoerper, Jdp1 antikoerper, mJDP1 antikoerper, DnaJ heat shock protein family (Hsp40) member C12 antikoerper, DnaJ (Hsp40) homolog, subfamily C, member 12 antikoerper, DNAJC12 antikoerper, dnajc12 antikoerper, Dnajc12 antikoerper

Hintergrund: This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.

Molekulargewicht: 23 kDa (MW of target protein)