CLUL1 Antikörper

Produktnummer ABIN632549

Produktdetails anti-CLUL1 Antikörper

Target: CLUL1 (Clusterin-Like 1 (Retinal) (CLUL1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLUL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Clusterin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAES

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Clusterin-Like 1 Blocking Peptide, catalog no. 33R-9042, is also available for use as a blocking control in assays to test for specificity of this Clusterin-Like 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLUL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLUL1

Target: CLUL1 (Clusterin-Like 1 (Retinal) (CLUL1))

Abstract: CLUL1 Produkte

Synonyme: RA337M antikoerper, clusterin like 1 antikoerper, CLUL1 antikoerper, Clul1 antikoerper

Hintergrund: CLUL1 is a secreted clusterin family glycoprotein that is expressed predominantly by cone photoreceptors of the retina. CLUL1 expression is downregulated in some forms of retinal disease.

Molekulargewicht: 54 kDa (MW of target protein)