TINAGL1 Antikörper (Middle Region)
-
- Target Alle TINAGL1 Antikörper anzeigen
- TINAGL1 (Tubulointerstitial Nephritis Antigen-Like 1 (TINAGL1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TINAGL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TINAGL1 antibody was raised against the middle region of TINAGL1
- Aufreinigung
- Affinity purified
- Immunogen
- TINAGL1 antibody was raised using the middle region of TINAGL1 corresponding to a region with amino acids ENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWG
- Top Product
- Discover our top product TINAGL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TINAGL1 Blocking Peptide, catalog no. 33R-2606, is also available for use as a blocking control in assays to test for specificity of this TINAGL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINAGL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TINAGL1 (Tubulointerstitial Nephritis Antigen-Like 1 (TINAGL1))
- Andere Bezeichnung
- TINAGL1 (TINAGL1 Produkte)
- Synonyme
- ARG1 antikoerper, LCN7 antikoerper, LIECG3 antikoerper, TINAGRP antikoerper, 1110021J17Rik antikoerper, AZ-1 antikoerper, AZ1 antikoerper, Arg1 antikoerper, Lcn7 antikoerper, TARP antikoerper, Tinagl antikoerper, gis5 antikoerper, tubulointerstitial nephritis antigen like 1 antikoerper, tubulointerstitial nephritis antigen-like 1 antikoerper, TINAGL1 antikoerper, Tinagl1 antikoerper
- Hintergrund
- TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.
- Molekulargewicht
- 52 kDa (MW of target protein)
-