TINAGL1 Antikörper (Middle Region)

Produktnummer ABIN632534

Der Kaninchen Polyklonal anti-TINAGL1 Antikörper wird verwendet zum Nachweis von TINAGL1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für TINAGL1 Antikörper (Middle Region) (ABIN632534)

Target: TINAGL1 (Tubulointerstitial Nephritis Antigen-Like 1 (TINAGL1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TINAGL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TINAGL1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TINAGL1 antibody was raised against the middle region of TINAGL1

Aufreinigung: Affinity purified

Immunogen: TINAGL1 antibody was raised using the middle region of TINAGL1 corresponding to a region with amino acids ENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TINAGL1 Blocking Peptide, (ABIN937992), is also available for use as a blocking control in assays to test for specificity of this TINAGL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINAGL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TINAGL1

Target: TINAGL1 (Tubulointerstitial Nephritis Antigen-Like 1 (TINAGL1))

Andere Bezeichnung: TINAGL1

Hintergrund: TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.

Molekulargewicht: 52 kDa (MW of target protein)