LDHAL6B Antikörper (Middle Region)

Produktnummer ABIN632531

Produktdetails anti-LDHAL6B Antikörper

Target: LDHAL6B (Lactate Dehydrogenase A-Like 6B (LDHAL6B))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LDHAL6B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LDHAL6 B antibody was raised against the middle region of LDHAL6

Aufreinigung: Affinity purified

Immunogen: LDHAL6 B antibody was raised using the middle region of LDHAL6 corresponding to a region with amino acids SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LDHAL6B Blocking Peptide, catalog no. 33R-8500, is also available for use as a blocking control in assays to test for specificity of this LDHAL6B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHAL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LDHAL6B

Target: LDHAL6B (Lactate Dehydrogenase A-Like 6B (LDHAL6B))

Andere Bezeichnung: LDHAL6B (LDHAL6B Produkte)

Synonyme: Ldhl antikoerper, LDHL antikoerper, Ldhal antikoerper, AI326310 antikoerper, 4933402O15Rik antikoerper, LDHAL6B antikoerper, LDH6B antikoerper, LDHAL6 antikoerper, lactate dehydrogenase A-like 6B antikoerper, lactate dehydrogenase A like 6B antikoerper, Ldhal6b antikoerper, LDHAL6B antikoerper

Hintergrund: The function of LDH protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 42 kDa (MW of target protein)