ZC2HC1C Antikörper (N-Term)

Produktnummer ABIN632527

Produktdetails anti-ZC2HC1C Antikörper

Target: ZC2HC1C (Zinc Finger, C2HC-Type Containing 1C (ZC2HC1C))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZC2HC1C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C14 ORF140 antibody was raised against the N terminal Of C14 rf140

Aufreinigung: Affinity purified

Immunogen: C14 ORF140 antibody was raised using the N terminal Of C14 rf140 corresponding to a region with amino acids QQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C14ORF140 Blocking Peptide, catalog no. 33R-7690, is also available for use as a blocking control in assays to test for specificity of this C14ORF140 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF140 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZC2HC1C

Target: ZC2HC1C (Zinc Finger, C2HC-Type Containing 1C (ZC2HC1C))

Andere Bezeichnung: C14ORF140 (ZC2HC1C Produkte)

Synonyme: C14orf140 antikoerper, FAM164C antikoerper, 2810002I04Rik antikoerper, AV046379 antikoerper, Fam164c antikoerper, RGD1307122 antikoerper, zinc finger C2HC-type containing 1C antikoerper, zinc finger, C2HC-type containing 1C antikoerper, ZC2HC1C antikoerper, Zc2hc1c antikoerper

Hintergrund: C14orf140 belongs to the UPF0418 family. The exact function of C14orf140 remains unknown.

Molekulargewicht: 31 kDa (MW of target protein)